PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00010.1_g00037.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 235aa    MW: 26845.4 Da    PI: 7.5707
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00010.1_g00037.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM135.82.9e-4261372128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgy 82 
                              + GfrF Pt+eel+ +yL++++eg++  ++++vi+ +d+++veP++Lp+    ++ ++ ++w+fF++r++++a+g r++r++ sgy
  Rsa1.0_00010.1_g00037.1   6 TIGFRFYPTEEELIAFYLRNQLEGRSgDTMHRVIPVLDVFEVEPSHLPNmageRCLGDAEQWFFFVPRQEREARGGRPSRTIGSGY 91 
                              68***********************96556678***************534553344778************************** PP

                      NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              Wkatg+  +v+sk+++ +g+kkt+vfy+grap+g+kt+W m+ey++
  Rsa1.0_00010.1_g00037.1  92 WKATGSPGPVFSKDNRMIGVKKTMVFYTGRAPTGRKTKWKMNEYKA 137
                              ********************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.89E-474162IPR003441NAC domain
PROSITE profilePS5100546.6575162IPR003441NAC domain
PfamPF023653.2E-227136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MTEELTIGFR FYPTEEELIA FYLRNQLEGR SGDTMHRVIP VLDVFEVEPS HLPNMAGERC  60
LGDAEQWFFF VPRQEREARG GRPSRTIGSG YWKATGSPGP VFSKDNRMIG VKKTMVFYTG  120
RAPTGRKTKW KMNEYKAVDK TFNVSTIPKL RHEFSLCRVY ITSGSSRAFD RRPMGNFQAE  180
RMLIRDVAVG ETSVRVESSP EASMSGGEHG YLSMNGEIVD GLTEPIWEWE QLNWP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-32516717170NO APICAL MERISTEM PROTEIN
1ut4_B1e-32516717170NO APICAL MERISTEM PROTEIN
1ut7_A1e-32516717170NO APICAL MERISTEM PROTEIN
1ut7_B1e-32516717170NO APICAL MERISTEM PROTEIN
3swm_A1e-32516720173NAC domain-containing protein 19
3swm_B1e-32516720173NAC domain-containing protein 19
3swm_C1e-32516720173NAC domain-containing protein 19
3swm_D1e-32516720173NAC domain-containing protein 19
3swp_A1e-32516720173NAC domain-containing protein 19
3swp_B1e-32516720173NAC domain-containing protein 19
3swp_C1e-32516720173NAC domain-containing protein 19
3swp_D1e-32516720173NAC domain-containing protein 19
4dul_A1e-32516717170NAC domain-containing protein 19
4dul_B1e-32516717170NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013665880.11e-160PREDICTED: NAC domain-containing protein 90-like
SwissprotQ9FMR31e-148NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A078DV641e-160A0A078DV64_BRANA; BnaA10g13930D protein
STRINGBra002408.1-P1e-159(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14452893
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.11e-149NAC domain containing protein 90